SCOPe 2.08: Domain d2xd7b_: 2xd7 B:

Lineage for d2xd7b_ (2xd7 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.50: Macro domain-like [52948] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest

4. Superfamily c.50.1: Macro domain-like [52949] (4 families)

5. Family c.50.1.2: Macro domain [89724] (7 proteins)
   found in different proteins, including macro-H2a histone and the Appr-1"-p processing enzyme

6. Protein automated matches [190472] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189352] (2 PDB entries)

8. Domain d2xd7b_: 2xd7 B: [170037]
   automated match to d1zr5a1

Details for d2xd7b_

PDB Entry: 2xd7, 2.09 Å

PDB Description: crystal structure of the macro domain of human core histone h2a

PDB Compounds: (B:) core histone macro-h2a.2

SCOPe Domain Sequences for d2xd7b_:

Sequence; same for both SEQRES and ATOM records:

>d2xd7b_ c.50.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpgdgftilsskslvlgqklsltqsdishigsmrvegivhpttaeidlkedigkalekag
gkefletvkelrksqgplevaeaavsqssglaakfvihchipqwgsdkceeqleetiknc
lsaaedkklksvafppfpsgrncfpkqtaaqvtlkaisahfddssasslknvyfllfdse
sigiyvqemakl

Timeline for d2xd7b_:

• d2xd7b_ first appeared in SCOPe 2.01
  
• d2xd7b_ appears in SCOPe 2.07