Lineage for d2xd7c_ (2xd7 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2881110Fold c.50: Macro domain-like [52948] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest
  4. 2881111Superfamily c.50.1: Macro domain-like [52949] (4 families) (S)
  5. 2881136Family c.50.1.2: Macro domain [89724] (7 proteins)
    found in different proteins, including macro-H2a histone and the Appr-1"-p processing enzyme
  6. 2881179Protein automated matches [190472] (8 species)
    not a true protein
  7. 2881223Species Human (Homo sapiens) [TaxId:9606] [189352] (2 PDB entries)
  8. 2881228Domain d2xd7c_: 2xd7 C: [170038]
    automated match to d1zr5a1

Details for d2xd7c_

PDB Entry: 2xd7 (more details), 2.09 Å

PDB Description: crystal structure of the macro domain of human core histone h2a
PDB Compounds: (C:) core histone macro-h2a.2

SCOPe Domain Sequences for d2xd7c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xd7c_ c.50.1.2 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dgpgdgftilsskslvlgqklsltqsdishigsmrvegivhpttaeidlkedigkaleka
ggkefletvkelrksqgplevaeaavsqssglaakfvihchipqwgsdkceeqleetikn
clsaaedkklksvafppfpsgrncfpkqtaaqvtlkaisahfddssasslknvyfllfds
esigiyvqemakl

SCOPe Domain Coordinates for d2xd7c_:

Click to download the PDB-style file with coordinates for d2xd7c_.
(The format of our PDB-style files is described here.)

Timeline for d2xd7c_: