Lineage for d1b3qb1 (1b3q B:293-354)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709045Fold a.30: ROP-like [47379] (8 superfamilies)
    4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist
  4. 2709085Superfamily a.30.2: Homodimeric domain of signal transducing histidine kinase [47384] (2 families) (S)
  5. 2709086Family a.30.2.1: Homodimeric domain of signal transducing histidine kinase [47385] (4 proteins)
  6. 2709091Protein Histidine kinase CheA [47388] (1 species)
  7. 2709092Species Thermotoga maritima [TaxId:2336] [47389] (1 PDB entry)
  8. 2709094Domain d1b3qb1: 1b3q B:293-354 [16994]
    Other proteins in same PDB: d1b3qa2, d1b3qa3, d1b3qb2, d1b3qb3
    complexed with hg

Details for d1b3qb1

PDB Entry: 1b3q (more details), 2.6 Å

PDB Description: crystal structure of chea-289, a signal transducing histidine kinase
PDB Compounds: (B:) protein (chemotaxis protein chea)

SCOPe Domain Sequences for d1b3qb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b3qb1 a.30.2.1 (B:293-354) Histidine kinase CheA {Thermotoga maritima [TaxId: 2336]}
sqtvrvdiekldnlmdlmgelviarsriletlkkynikeldeslshlsritldlqnvvmk
ir

SCOPe Domain Coordinates for d1b3qb1:

Click to download the PDB-style file with coordinates for d1b3qb1.
(The format of our PDB-style files is described here.)

Timeline for d1b3qb1: