PDB entry 1b3q

View 1b3q on RCSB PDB site
Description: crystal structure of chea-289, a signal transducing histidine kinase
Class: transferase
Keywords: histine kinase, signal transduction, chemotaxis, multi-domains protein, transferase
Deposited on 1998-12-14, released 1999-12-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.213
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (chemotaxis protein chea)
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q56310 (0-378)
      • engineered (228-229)
      • engineered (252)
    Domains in SCOPe 2.07: d1b3qa1, d1b3qa2, d1b3qa3
  • Chain 'B':
    Compound: protein (chemotaxis protein chea)
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q56310 (0-End)
      • engineered (228-229)
      • engineered (252)
    Domains in SCOPe 2.07: d1b3qb1, d1b3qb2, d1b3qb3
  • Heterogens: HG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b3qA (A:)
    sqtvrvdiekldnlmdlmgelviarsriletlkkynikeldeslshlsritldlqnvvmk
    irmvpisfvfnrfprmvrdlakkmnkevnfimrgedteldrtfveeigepllhllrnaid
    hgiepkeeriakgkppigtlilsarhegnnvvieveddgrgidkekiirkaiekglides
    kaatlsdqeilnflfvpgfstkekvsevsgrgvgmdvvknvveslngsmgiesekdkgtk
    vtirlpltlaiicallvkvnnlvyaipianidtilsiskediqrvqdrdvivirgevipv
    yrlwevlqiehkeeleemeavivrvgnrkygivvddllgqddivikslgkvfsevkefsg
    aailgdgsialiinvsgiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b3qA (A:)
    sqtvrvdiekldnlmdlmgelviarsriletlkkynikeldeslshlsritldlqnvvmk
    irmvpisfvfnrfprmvrdlakkmnkevnfimrgedteldrtfveeigepllhllrnaid
    hgiepkeeriakgkppigtlilsarhegnnvvieveddgrgidkekiirkaiekglides
    kaatlsdqeilnflfvpgfsgvgmdvvknvveslngsmgiesekdkgtkvtirlpltlai
    icallvkvnnlvyaipianidtilsiskediqrvqdrdvivirgevipvyrlwevlqieh
    keeleemeavivrvgnrkygivvddllgqddivikslgkvfsevkefsgaailgdgsial
    iinvsgiv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1b3qB (B:)
    sqtvrvdiekldnlmdlmgelviarsriletlkkynikeldeslshlsritldlqnvvmk
    irmvpisfvfnrfprmvrdlakkmnkevnfimrgedteldrtfveeigepllhllrnaid
    hgiepkeeriakgkppigtlilsarhegnnvvieveddgrgidkekiirkaiekglides
    kaatlsdqeilnflfvpgfstkekvsevsgrgvgmdvvknvveslngsmgiesekdkgtk
    vtirlpltlaiicallvkvnnlvyaipianidtilsiskediqrvqdrdvivirgevipv
    yrlwevlqiehkeeleemeavivrvgnrkygivvddllgqddivikslgkvfsevkefsg
    aailgdgsialiinvsgiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b3qB (B:)
    sqtvrvdiekldnlmdlmgelviarsriletlkkynikeldeslshlsritldlqnvvmk
    irmvpisfvfnrfprmvrdlakkmnkevnfimrgedteldrtfveeigepllhllrnaid
    hgiepkeeriakgkppigtlilsarhegnnvvieveddgrgidkekiirkaiekglides
    kaatlsdqeilnflfvpgfstkekvsevsgrgvgmdvvknvveslngsmgiesekdkgtk
    vtirlpltlaiicallvkvnnlvyaipianidtilsiskediqrvqdrdvivirgevipv
    yrlwevlqimeavivrvgnrkygivvddllgqddivikslgkvfsevkefsgaailgdgs
    ialiinvsgi