SCOPe 2.08: Domain d1b3qa2: 1b3q A:540-671

Lineage for d1b3qa2 (1b3q A:540-671)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.7: CheW-like [50341] (2 families)
   automatically mapped to Pfam PF01584

5. Family b.40.7.1: CheW-like [50342] (3 proteins)
   duplication: tandem repeat of two swapped domains, one with a canonical OB-fold topology and one with a circular permutation

6. Protein Histidine kinase CheA, C-terminal domain [50343] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [50344] (2 PDB entries)

8. Domain d1b3qa2: 1b3q A:540-671 [25454]
   Other proteins in same PDB: d1b3qa1, d1b3qa3, d1b3qb1, d1b3qb3
   complexed with hg

Details for d1b3qa2

PDB Entry: 1b3q, 2.6 Å

PDB Description: crystal structure of chea-289, a signal transducing histidine kinase

PDB Compounds: (A:) protein (chemotaxis protein chea)

SCOPe Domain Sequences for d1b3qa2:

Sequence; same for both SEQRES and ATOM records:

>d1b3qa2 b.40.7.1 (A:540-671) Histidine kinase CheA, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
tlaiicallvkvnnlvyaipianidtilsiskediqrvqdrdvivirgevipvyrlwevl
qiehkeeleemeavivrvgnrkygivvddllgqddivikslgkvfsevkefsgaailgdg
sialiinvsgiv

Timeline for d1b3qa2:

• d1b3qa2 first appeared (with stable ids) in SCOP 1.55
  
• d1b3qa2 appears in SCOPe 2.07