![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.30: ROP-like [47379] (8 superfamilies) 4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist |
![]() | Superfamily a.30.2: Homodimeric domain of signal transducing histidine kinase [47384] (2 families) ![]() |
![]() | Family a.30.2.1: Homodimeric domain of signal transducing histidine kinase [47385] (4 proteins) |
![]() | Protein Histidine kinase CheA [47388] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [47389] (1 PDB entry) |
![]() | Domain d1b3qa1: 1b3q A:293-354 [16993] Other proteins in same PDB: d1b3qa2, d1b3qa3, d1b3qb2, d1b3qb3 complexed with hg |
PDB Entry: 1b3q (more details), 2.6 Å
SCOPe Domain Sequences for d1b3qa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b3qa1 a.30.2.1 (A:293-354) Histidine kinase CheA {Thermotoga maritima [TaxId: 2336]} sqtvrvdiekldnlmdlmgelviarsriletlkkynikeldeslshlsritldlqnvvmk ir
Timeline for d1b3qa1: