![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
![]() | Protein automated matches [190100] (10 species) not a true protein |
![]() | Species Arenicola marina [TaxId:6344] [188412] (4 PDB entries) |
![]() | Domain d2wfcc_: 2wfc C: [169303] automated match to d1urma_ complexed with act |
PDB Entry: 2wfc (more details), 1.75 Å
SCOPe Domain Sequences for d2wfcc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wfcc_ c.47.1.10 (C:) automated matches {Arenicola marina [TaxId: 6344]} pikegdklpavtvfgatpndkvnmaelfagkkgvlfavpgaftpgsskthlpgyveqaaa ihgkgvdiiacmavndsfvmdawgkahgaddkvqmladpggaftkavdmeldlsavlgnv rskryslviedgvvtkvnvepdgkgltcslapnilsqlg
Timeline for d2wfcc_: