Lineage for d2wfca_ (2wfc A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1168056Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1168057Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1169030Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 1169352Protein automated matches [190100] (10 species)
    not a true protein
  7. 1169450Species Arenicola marina [TaxId:6344] [188412] (4 PDB entries)
  8. 1169455Domain d2wfca_: 2wfc A: [169301]
    automated match to d1urma_
    complexed with act

Details for d2wfca_

PDB Entry: 2wfc (more details), 1.75 Å

PDB Description: crystal structure of peroxiredoxin 5 from arenicola marina
PDB Compounds: (A:) peroxiredoxin 5

SCOPe Domain Sequences for d2wfca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wfca_ c.47.1.10 (A:) automated matches {Arenicola marina [TaxId: 6344]}
pikegdklpavtvfgatpndkvnmaelfagkkgvlfavpgaftpgsskthlpgyveqaaa
ihgkgvdiiacmavndsfvmdawgkahgaddkvqmladpggaftkavdmeldlsavlgnv
rskryslviedgvvtkvnvepdgkgltcslapnilsqlg

SCOPe Domain Coordinates for d2wfca_:

Click to download the PDB-style file with coordinates for d2wfca_.
(The format of our PDB-style files is described here.)

Timeline for d2wfca_: