| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
| Protein automated matches [190100] (21 species) not a true protein |
| Species Arenicola marina [TaxId:6344] [188412] (4 PDB entries) |
| Domain d2wfcc1: 2wfc C:29-186 [169303] Other proteins in same PDB: d2wfca2, d2wfcb2, d2wfcc2, d2wfcd2 automated match to d1urma_ complexed with act |
PDB Entry: 2wfc (more details), 1.75 Å
SCOPe Domain Sequences for d2wfcc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wfcc1 c.47.1.10 (C:29-186) automated matches {Arenicola marina [TaxId: 6344]}
pikegdklpavtvfgatpndkvnmaelfagkkgvlfavpgaftpgsskthlpgyveqaaa
ihgkgvdiiacmavndsfvmdawgkahgaddkvqmladpggaftkavdmeldlsavlgnv
rskryslviedgvvtkvnvepdgkgltcslapnilsql
Timeline for d2wfcc1: