SCOPe 2.08: Domain d2wfcc1: 2wfc C:29-186

Lineage for d2wfcc1 (2wfc C:29-186)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein automated matches [190100] (21 species)
   not a true protein

7. Species Arenicola marina [TaxId:6344] [188412] (4 PDB entries)

8. Domain d2wfcc1: 2wfc C:29-186 [169303]
   Other proteins in same PDB: d2wfca2, d2wfcb2, d2wfcc2, d2wfcd2
   automated match to d1urma_
   complexed with act

Details for d2wfcc1

PDB Entry: 2wfc, 1.75 Å

PDB Description: crystal structure of peroxiredoxin 5 from arenicola marina

PDB Compounds: (C:) peroxiredoxin 5

SCOPe Domain Sequences for d2wfcc1:

Sequence; same for both SEQRES and ATOM records:

>d2wfcc1 c.47.1.10 (C:29-186) automated matches {Arenicola marina [TaxId: 6344]}
pikegdklpavtvfgatpndkvnmaelfagkkgvlfavpgaftpgsskthlpgyveqaaa
ihgkgvdiiacmavndsfvmdawgkahgaddkvqmladpggaftkavdmeldlsavlgnv
rskryslviedgvvtkvnvepdgkgltcslapnilsql

Timeline for d2wfcc1:

• d2wfcc1 first appeared in SCOPe 2.01, called d2wfcc_
  
• d2wfcc1 appears in SCOPe 2.07