SCOPe 2.08: Domain d2w8be1: 2w8b E:68-173

Lineage for d2w8be1 (2w8b E:68-173)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.7: OmpA-like [103088] (2 families)

5. Family d.79.7.1: OmpA-like [103089] (3 proteins)
   Pfam PF00691

6. Protein automated matches [190318] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187135] (2 PDB entries)

8. Domain d2w8be1: 2w8b E:68-173 [169107]
   Other proteins in same PDB: d2w8ba1, d2w8ba2, d2w8bb1, d2w8bb2, d2w8bd1, d2w8bd2, d2w8be2, d2w8bf1, d2w8bf2, d2w8bg2, d2w8bh2
   automated match to d1oapa_
   complexed with act, gol, so4

Details for d2w8be1

PDB Entry: 2w8b, 1.86 Å

PDB Description: crystal structure of processed tolb in complex with pal

PDB Compounds: (E:) peptidoglycan-associated lipoprotein

SCOPe Domain Sequences for d2w8be1:

Sequence; same for both SEQRES and ATOM records:

>d2w8be1 d.79.7.1 (E:68-173) automated matches {Escherichia coli [TaxId: 562]}
nnivyfdldkydirsdfaqmldahanflrsnpsykvtveghadergtpeynislgerran
avkmylqgkgvsadqisivsygkekpavlghdeaaysknrravlvy

Timeline for d2w8be1:

• d2w8be1 first appeared in SCOPe 2.01, called d2w8be_
  
• d2w8be1 appears in SCOPe 2.07