Lineage for d2w8bh1 (2w8b H:67-173)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2960608Superfamily d.79.7: OmpA-like [103088] (2 families) (S)
  5. 2960609Family d.79.7.1: OmpA-like [103089] (3 proteins)
    Pfam PF00691
  6. 2960618Protein automated matches [190318] (2 species)
    not a true protein
  7. 2960619Species Escherichia coli [TaxId:562] [187135] (2 PDB entries)
  8. 2960627Domain d2w8bh1: 2w8b H:67-173 [169109]
    Other proteins in same PDB: d2w8ba1, d2w8ba2, d2w8bb1, d2w8bb2, d2w8bd1, d2w8bd2, d2w8be2, d2w8bf1, d2w8bf2, d2w8bg2, d2w8bh2
    automated match to d1oapa_
    complexed with act, gol, so4

Details for d2w8bh1

PDB Entry: 2w8b (more details), 1.86 Å

PDB Description: crystal structure of processed tolb in complex with pal
PDB Compounds: (H:) peptidoglycan-associated lipoprotein

SCOPe Domain Sequences for d2w8bh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w8bh1 d.79.7.1 (H:67-173) automated matches {Escherichia coli [TaxId: 562]}
qnnivyfdldkydirsdfaqmldahanflrsnpsykvtveghadergtpeynislgerra
navkmylqgkgvsadqisivsygkekpavlghdeaaysknrravlvy

SCOPe Domain Coordinates for d2w8bh1:

Click to download the PDB-style file with coordinates for d2w8bh1.
(The format of our PDB-style files is described here.)

Timeline for d2w8bh1: