Lineage for d2w8ba1 (2w8b A:22-161)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2881870Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2882039Superfamily c.51.2: TolB, N-terminal domain [52964] (2 families) (S)
  5. 2882053Family c.51.2.0: automated matches [232575] (1 protein)
    not a true family
  6. 2882054Protein automated matches [232576] (4 species)
    not a true protein
  7. 2882058Species Escherichia coli [TaxId:562] [232577] (2 PDB entries)
  8. 2882059Domain d2w8ba1: 2w8b A:22-161 [238928]
    Other proteins in same PDB: d2w8ba2, d2w8bb2, d2w8bc_, d2w8bd2, d2w8be1, d2w8be2, d2w8bf2, d2w8bg1, d2w8bg2, d2w8bh1, d2w8bh2
    automated match to d2ivza2
    complexed with act, gol, so4

Details for d2w8ba1

PDB Entry: 2w8b (more details), 1.86 Å

PDB Description: crystal structure of processed tolb in complex with pal
PDB Compounds: (A:) protein tolb

SCOPe Domain Sequences for d2w8ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w8ba1 c.51.2.0 (A:22-161) automated matches {Escherichia coli [TaxId: 562]}
evrividsgvdsgrpigvvpfqwagpgaapediggivaadlrnsgkfnpldrarlpqqpg
saqevqpaawsalgidavvvgqvtpnpdgsynvayqlvdtggapgtvlaqnsykvnkqwl
ryaghtasdevfekltgikg

SCOPe Domain Coordinates for d2w8ba1:

Click to download the PDB-style file with coordinates for d2w8ba1.
(The format of our PDB-style files is described here.)

Timeline for d2w8ba1: