SCOPe 2.04: Domain d2w5ua_: 2w5u A:

Lineage for d2w5ua_ (2w5u A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
   binds FMN

6. Protein automated matches [190443] (4 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:210] [187348] (2 PDB entries)

8. Domain d2w5ua_: 2w5u A: [169074]
   automated match to d1fuea_
   complexed with fmn, ic3

Details for d2w5ua_

PDB Entry: 2w5u, 2.62 Å

PDB Description: flavodoxin from helicobacter pylori in complex with the c3 inhibitor

PDB Compounds: (A:) flavodoxin

SCOPe Domain Sequences for d2w5ua_:

Sequence; same for both SEQRES and ATOM records:

>d2w5ua_ c.23.5.1 (A:) automated matches {Helicobacter pylori [TaxId: 210]}
gkigiffgtdsgnaeaiaekiskaignaevvdvakaskeqfnsftkvilvaptagagdlq
tdwedflgtleasdfanktiglvglgdqdtysetfaegifhiyekakagkvvgqtstdgy
hfeaskaveggkfvglvidednqddltderiskwveqvrgsfa

Timeline for d2w5ua_:

• d2w5ua_ first appeared in SCOPe 2.01
  
• d2w5ua_ appears in SCOPe 2.03
  
• d2w5ua_ appears in SCOPe 2.05
  
• d2w5ua_ appears in the current release, SCOPe 2.08