| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) ![]() |
| Family c.23.5.1: Flavodoxin-related [52219] (6 proteins) binds FMN |
| Protein Flavodoxin [52220] (9 species) |
| Species Helicobacter pylori [TaxId:210] [69446] (1 PDB entry) |
| Domain d1fuea_: 1fue A: [65054] complexed with fmn |
PDB Entry: 1fue (more details), 2.4 Å
SCOPe Domain Sequences for d1fuea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fuea_ c.23.5.1 (A:) Flavodoxin {Helicobacter pylori [TaxId: 210]}
gkigiffgtdsgnaeaiaekiskaignaevvdvakaskeqfngftkvilvaptagagdlq
tdwedflgtleasdfanktiglvglgdqdtysetfaegifhiyekakagkvvgqtstdgy
hfaaskaveggkfvglvidednqddltderiakwveqvrgsfa
Timeline for d1fuea_: