Lineage for d1fuea_ (1fue A:)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.23: Flavodoxin-like [52171] (17 superfamilies) 
Superfamily c.23.5: Flavoproteins [52218] (3 families) 
Family c.23.5.1: Flavodoxin-related [52219] (3 proteins) Protein Flavodoxin [52220] (7 species) 
Species Helicobacter pylori [TaxId:210] [69446] (1 PDB entry) 
Domain d1fuea_: 1fue A: [65054]
Details for d1fuea_
PDB Entry: 1fue (more details), 2.4 Å
PDB Description: flavodoxin from helicobacter pylori
SCOP Domain Sequences for d1fuea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fuea_ c.23.5.1 (A:) Flavodoxin {Helicobacter pylori}
gkigiffgtdsgnaeaiaekiskaignaevvdvakaskeqfngftkvilvaptagagdlq
tdwedflgtleasdfanktiglvglgdqdtysetfaegifhiyekakagkvvgqtstdgy
hfaaskaveggkfvglvidednqddltderiakwveqvrgsfa
SCOP Domain Coordinates for d1fuea_:
Click to download the PDB-style file with coordinates for d1fuea_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fuea_:
- d1fuea_ is new in SCOP 1.59
- d1fuea_ appears in SCOP 1.61
- d1fuea_ appears in the current release, SCOPe 2.08
View in 3D