| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) ![]() |
| Family c.23.5.1: Flavodoxin-related [52219] (6 proteins) binds FMN |
| Protein automated matches [190443] (3 species) not a true protein |
| Species Helicobacter pylori [TaxId:210] [187348] (2 PDB entries) |
| Domain d2w5ua_: 2w5u A: [169074] automated match to d1fuea_ complexed with fmn, ic3 |
PDB Entry: 2w5u (more details), 2.62 Å
SCOPe Domain Sequences for d2w5ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w5ua_ c.23.5.1 (A:) automated matches {Helicobacter pylori [TaxId: 210]}
gkigiffgtdsgnaeaiaekiskaignaevvdvakaskeqfnsftkvilvaptagagdlq
tdwedflgtleasdfanktiglvglgdqdtysetfaegifhiyekakagkvvgqtstdgy
hfeaskaveggkfvglvidednqddltderiskwveqvrgsfa
Timeline for d2w5ua_: