Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d2w5ua_ (2w5u A:)

  1. Root: SCOP 1.75B
  2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. Family c.23.5.1: Flavodoxin-related [52219] (6 protein domains)
    binds FMN
  6. Protein automated matches [190443] (3 species)
    not a true protein
  7. Species Helicobacter pylori [TaxId:210] [187348] (2 PDB entries)
  8. Domain d2w5ua_: 2w5u A: [169074]
    automated match to d1fuea_
    complexed with fmn, ic3

Details for d2w5ua_

PDB Entry: 2w5u (more details)
PDB Description: flavodoxin from helicobacter pylori in complex with the c3 inhibitor
PDB Compounds: (A:) flavodoxin

SCOP Domain Sequences for d2w5ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w5ua_ c.23.5.1 (A:) automated matches {Helicobacter pylori [TaxId: 210]}
gkigiffgtdsgnaeaiaekiskaignaevvdvakaskeqfnsftkvilvaptagagdlq
tdwedflgtleasdfanktiglvglgdqdtysetfaegifhiyekakagkvvgqtstdgy
hfeaskaveggkfvglvidednqddltderiskwveqvrgsfa

SCOP Domain Coordinates for d2w5ua_:

Click to download the PDB-style file with coordinates for d2w5ua_.
(The format of our PDB-style files is described here.)

Timeline for d2w5ua_:

d2w5ua_ appears in SCOP 1.75A


d2w5ua_
(click for larger image)


d2w5ua_ in context of chain



d2w5ua_ in context of PDB
Domains from other chains:
d2w5ub_

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu