Lineage for d2w3la_ (2w3l A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021035Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 3021129Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 3021130Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
    Pfam PF00452
  6. 3021485Protein automated matches [190236] (3 species)
    not a true protein
  7. 3021486Species Human (Homo sapiens) [TaxId:9606] [188722] (26 PDB entries)
  8. 3021516Domain d2w3la_: 2w3l A: [169043]
    automated match to d1gjha_
    complexed with dro

Details for d2w3la_

PDB Entry: 2w3l (more details), 2.1 Å

PDB Description: crystal structure of chimaeric bcl2-xl and phenyl tetrahydroisoquinoline amide complex
PDB Compounds: (A:) Apoptosis regulator Bcl-2

SCOPe Domain Sequences for d2w3la_:

Sequence, based on SEQRES records: (download)

>d2w3la_ f.1.4.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ydnreivmkyihyklsqrgyewdagadsevvhktlreagddfsrryrrdfaemssglhlt
pftargrfatvveelfrdgvnwgrivaffefggvmcvesvnremsplvdnialwmteyln
rhlhtwiqdnggwdafvelygpsm

Sequence, based on observed residues (ATOM records): (download)

>d2w3la_ f.1.4.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ydnreivmkyihyklsqrgyewdasevvhktlreagddfsrryrrdfaemssglhltpft
argrfatvveelfrdgvnwgrivaffefggvmcvesvnremsplvdnialwmteylnrhl
htwiqdnggwdafvelygpsm

SCOPe Domain Coordinates for d2w3la_:

Click to download the PDB-style file with coordinates for d2w3la_.
(The format of our PDB-style files is described here.)

Timeline for d2w3la_: