SCOPe 2.08: Domain d2w3lb_: 2w3l B:

Lineage for d2w3lb_ (2w3l B:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein automated matches [190236] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188722] (26 PDB entries)

8. Domain d2w3lb_: 2w3l B: [169044]
   automated match to d1gjha_
   complexed with dro

Details for d2w3lb_

PDB Entry: 2w3l, 2.1 Å

PDB Description: crystal structure of chimaeric bcl2-xl and phenyl tetrahydroisoquinoline amide complex

PDB Compounds: (B:) Apoptosis regulator Bcl-2

SCOPe Domain Sequences for d2w3lb_:

Sequence; same for both SEQRES and ATOM records:

>d2w3lb_ f.1.4.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ydnreivmkyihyklsqrgyewdagadsevvhktlreagddfsrryrrdfaemssglhlt
pftargrfatvveelfrdgvnwgrivaffefggvmcvesvnremsplvdnialwmteyln
rhlhtwiqdnggwdafvelygp

Timeline for d2w3lb_:

• d2w3lb_ first appeared in SCOPe 2.01
  
• d2w3lb_ appears in SCOPe 2.07