![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
![]() | Superfamily a.26.1: 4-helical cytokines [47266] (4 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
![]() | Family a.26.1.2: Short-chain cytokines [47286] (14 proteins) |
![]() | Protein Interleukin-4 (IL-4) [47291] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47292] (18 PDB entries) |
![]() | Domain d1itma1: 1itm A:1-129 [16858] Other proteins in same PDB: d1itma2 |
PDB Entry: 1itm (more details)
SCOPe Domain Sequences for d1itma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1itma1 a.26.1.2 (A:1-129) Interleukin-4 (IL-4) {Human (Homo sapiens) [TaxId: 9606]} hkcditlqeiiktlnslteqktlcteltvtdifaaskntteketfcraatvlrqfyshhe kdtrclgataqqfhrhkqlirflkrldrnlwglaglnscpvkeanqstlenflerlktim rekyskcss
Timeline for d1itma1: