PDB entry 1itm

View 1itm on RCSB PDB site
Description: analysis of the solution structure of human interleukin 4 determined by heteronuclear three-dimensional nuclear magnetic resonance techniques
Class: cytokine
Keywords: cytokine
Deposited on 1994-02-28, released 1994-05-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: interleukin-4
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05112 (1-129)
  Domains in SCOPe 2.08: d1itma1, d1itma2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1itmA (A:)
  mhkcditlqeiiktlnslteqktlcteltvtdifaaskntteketfcraatvlrqfyshh
  ekdtrclgataqqfhrhkqlirflkrldrnlwglaglnscpvkeanqstlenflerlkti
  mrekyskcss