Lineage for d2v9tb_ (2v9t B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2851636Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2851705Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2851922Family c.10.2.0: automated matches [191489] (1 protein)
    not a true family
  6. 2851923Protein automated matches [190787] (14 species)
    not a true protein
  7. 2851937Species Human (Homo sapiens) [TaxId:9606] [188042] (21 PDB entries)
  8. 2851938Domain d2v9tb_: 2v9t B: [168412]
    Other proteins in same PDB: d2v9ta_
    automated match to d1w8aa_

Details for d2v9tb_

PDB Entry: 2v9t (more details), 1.7 Å

PDB Description: Complex between the second LRR domain of Slit2 and The first Ig domain from Robo1
PDB Compounds: (B:) slit homolog 2 protein n-product

SCOPe Domain Sequences for d2v9tb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v9tb_ c.10.2.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gslhcpaactcsnnivdcrgkglteiptnlpetiteirleqntikvippgafspykklrr
idlsnnqiselapdafqglrslnslvlygnkitelpkslfeglfslqllllnankinclr
vdafqdlhnlnllslydnklqtiakgtfsplraiqtmhlaqnpficdchlkwladylhtn
pietsgarctsprrlankrigqikskkfrc

SCOPe Domain Coordinates for d2v9tb_:

Click to download the PDB-style file with coordinates for d2v9tb_.
(The format of our PDB-style files is described here.)

Timeline for d2v9tb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2v9ta_