Class a: All alpha proteins [46456] (290 folds) |
Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) there are two different topoisomers of this fold with different entanglements of the two crossover connections |
Family a.26.1.1: Long-chain cytokines [47267] (10 proteins) |
Protein Granulocyte-colony stimulating factor (G-CSF) [47268] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [47269] (4 PDB entries) |
Domain d1cd9c_: 1cd9 C: [16816] Other proteins in same PDB: d1cd9b1, d1cd9b2, d1cd9d1, d1cd9d2 complexed with nag |
PDB Entry: 1cd9 (more details), 2.8 Å
SCOPe Domain Sequences for d1cd9c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cd9c_ a.26.1.1 (C:) Granulocyte-colony stimulating factor (G-CSF) {Human (Homo sapiens) [TaxId: 9606]} asslpqsfllkcleqvrkiqgdgaalqeklcatyklchpeelvllghslgipwaplsscp sqalqlagclsqlhsglflyqgllqalegispelgptldtlqldvadfattiwqqmeelg mapalqptqgampafasafqrraggvlvashlqsflevsyrvlrhlaqp
Timeline for d1cd9c_: