SCOPe 2.08: Domain d2rexb_: 2rex B:

Lineage for d2rexb_ (2rex B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (37 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries)

8. Domain d2rexb_: 2rex B: [168068]
   Other proteins in same PDB: d2rexa_, d2rexc_
   automated match to d1gwna_
   complexed with ca, gnp, mg, unx

Details for d2rexb_

PDB Entry: 2rex, 2.3 Å

PDB Description: crystal structure of the effector domain of plxnb1 bound with rnd1 gtpase

PDB Compounds: (B:) rho-related GTP-binding protein rho6

SCOPe Domain Sequences for d2rexb_:

Sequence, based on SEQRES records:

>d2rexb_ c.37.1.8 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rcklvlvgdvqcgktamlqvlakdcypetyvptvfenytacleteeqrvelslwdtsgsp
yydnvrplcysdsdavllcfdisrpetvdsalkkwrteildycpstrvlligcktdlrtd
lstlmelshqkqapisyeqgcaiakqlgaeiylegsaftseksihsifrtasmlcl

Sequence, based on observed residues (ATOM records):

>d2rexb_ c.37.1.8 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rcklvlvgdvqcgktamlqvlakdcypetyvptvfenytacleqrvelslwdtsgspyyd
nvrplcysdsdavllcfdisrpetvalkkwrteildycpstrvlligcktdlrtdlstlm
elshqkqapisyeqgcaiakqlgaeiylegsaftseksihsifrtasmlcl

Timeline for d2rexb_:

• d2rexb_ first appeared in SCOPe 2.01
  
• d2rexb_ appears in SCOPe 2.07