Lineage for d2rexb_ (2rex B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 987698Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 988558Protein automated matches [190047] (13 species)
    not a true protein
  7. 988585Species Human (Homo sapiens) [TaxId:9606] [186768] (67 PDB entries)
  8. 988677Domain d2rexb_: 2rex B: [168068]
    automated match to d1gwna_
    complexed with ca, gnp, mg, unx

Details for d2rexb_

PDB Entry: 2rex (more details), 2.3 Å

PDB Description: crystal structure of the effector domain of plxnb1 bound with rnd1 gtpase
PDB Compounds: (B:) rho-related GTP-binding protein rho6

SCOPe Domain Sequences for d2rexb_:

Sequence, based on SEQRES records: (download)

>d2rexb_ c.37.1.8 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rcklvlvgdvqcgktamlqvlakdcypetyvptvfenytacleteeqrvelslwdtsgsp
yydnvrplcysdsdavllcfdisrpetvdsalkkwrteildycpstrvlligcktdlrtd
lstlmelshqkqapisyeqgcaiakqlgaeiylegsaftseksihsifrtasmlcl

Sequence, based on observed residues (ATOM records): (download)

>d2rexb_ c.37.1.8 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rcklvlvgdvqcgktamlqvlakdcypetyvptvfenytacleqrvelslwdtsgspyyd
nvrplcysdsdavllcfdisrpetvalkkwrteildycpstrvlligcktdlrtdlstlm
elshqkqapisyeqgcaiakqlgaeiylegsaftseksihsifrtasmlcl

SCOPe Domain Coordinates for d2rexb_:

Click to download the PDB-style file with coordinates for d2rexb_.
(The format of our PDB-style files is described here.)

Timeline for d2rexb_: