| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
| Family d.15.1.10: Rho GTPase binding domain [310659] (3 proteins) Pfam PF08337 |
| Protein Plexin-B1 [310822] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [311089] (2 PDB entries) |
| Domain d2rexc_: 2rex C: [289633] Other proteins in same PDB: d2rexb_, d2rexd_ complexed with ca, gnp, mg, unx |
PDB Entry: 2rex (more details), 2.3 Å
SCOPe Domain Sequences for d2rexc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rexc_ d.15.1.10 (C:) Plexin-B1 {Human (Homo sapiens) [TaxId: 9606]}
yrpltlnallavgpgageaqgvpvkvldcdtisqakekmldqlykgvpltqrpdprtldv
ewrsgvaghlilsdedvtsevqglwrrlntlqhykvpdgatvalvpc
Timeline for d2rexc_: