SCOPe 2.08: Domain d1fz1d_: 1fz1 D:

Lineage for d1fz1d_ (1fz1 D:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)

6. Protein Methane monooxygenase hydrolase beta subunit [88792] (2 species)

7. Species Methylococcus capsulatus [TaxId:414] [88793] (27 PDB entries)

8. Domain d1fz1d_: 1fz1 D: [16747]
   Other proteins in same PDB: d1fz1a_, d1fz1b_, d1fz1e_, d1fz1f_
   complexed with ca, fe, fmt
   has additional insertions and/or extensions that are not grouped together

Details for d1fz1d_

PDB Entry: 1fz1, 1.96 Å

PDB Description: methane monooxygenase hydroxylase, form iii oxidized

PDB Compounds: (D:) methane monooxygenase component a, beta chain

SCOPe Domain Sequences for d1fz1d_:

Sequence; same for both SEQRES and ATOM records:

>d1fz1d_ a.25.1.2 (D:) Methane monooxygenase hydrolase beta subunit {Methylococcus capsulatus [TaxId: 414]}
smlgerrrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnad
wiaggldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytd
rflqgysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvslaf
wgfdkidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdw
nesafsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyyn
clgddpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvd
dwiedyasridfkadrdqivkavlagl

Timeline for d1fz1d_:

• d1fz1d_ first appeared (with stable ids) in SCOP 1.55
  
• d1fz1d_ appears in SCOPe 2.07