Lineage for d1dpse_ (1dps E:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.25: Ferritin-like [47239] (1 superfamily) Superfamily a.25.1: Ferritin-like [47240] (2 families) 
Family a.25.1.1: Ferritin [47241] (4 proteins) Protein Dodecameric ferritin homolog DPS [47250] (2 species) Species Escherichia coli [TaxId:562] [47251] (1 PDB entry) 
Domain d1dpse_: 1dps E: [16720]
Details for d1dpse_
PDB Entry: 1dps (more details), 1.6 Å
PDB Description: the crystal structure of dps, a ferritin homolog that binds and protects dna
SCOP Domain Sequences for d1dpse_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dpse_ a.25.1.1 (E:) Dodecameric ferritin homolog DPS {Escherichia coli}
llytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrtal
idhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandvr
kaigeakdddtadiltaasrdldkflwfiecnie
SCOP Domain Coordinates for d1dpse_:
Click to download the PDB-style file with coordinates for d1dpse_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dpse_:
- d1dpse_ appears in SCOP 1.57
- d1dpse_ appears in the current release, SCOPe 2.08
View in 3D
