Lineage for d1dpsl_ (1dps L:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2448Fold a.25: Ferritin-like [47239] (1 superfamily)
  4. 2449Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
  5. 2450Family a.25.1.1: Ferritin [47241] (4 proteins)
  6. 2525Protein Dodecameric ferritin homolog DPS [47250] (2 species)
  7. 2526Species Escherichia coli [TaxId:562] [47251] (1 PDB entry)
  8. 2538Domain d1dpsl_: 1dps L: [16727]

Details for d1dpsl_

PDB Entry: 1dps (more details), 1.6 Å

PDB Description: the crystal structure of dps, a ferritin homolog that binds and protects dna

SCOP Domain Sequences for d1dpsl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dpsl_ a.25.1.1 (L:) Dodecameric ferritin homolog DPS {Escherichia coli}
llytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrtal
idhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandvr
kaigeakdddtadiltaasrdldkflwfiecnie

SCOP Domain Coordinates for d1dpsl_:

Click to download the PDB-style file with coordinates for d1dpsl_.
(The format of our PDB-style files is described here.)

Timeline for d1dpsl_: