Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.114: DsrEFH-like [75168] (1 superfamily) 3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 43215 |
Superfamily c.114.1: DsrEFH-like [75169] (3 families) |
Family c.114.1.0: automated matches [191517] (1 protein) not a true family |
Protein automated matches [190869] (1 species) not a true protein |
Species Sulfolobus tokodaii [TaxId:273063] [188218] (1 PDB entry) |
Domain d2pd2a_: 2pd2 A: [167135] automated match to d1l1sa_ |
PDB Entry: 2pd2 (more details), 2.06 Å
SCOPe Domain Sequences for d2pd2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pd2a_ c.114.1.0 (A:) automated matches {Sulfolobus tokodaii [TaxId: 273063]} mkvvvqikdfdkvpqalrsvinlyndikdaeievvlhqsaikallkdsdtrsiiedlikk nilivgcensirsqnlshdqlipgikivtsgvgeivrkqsegwiylal
Timeline for d2pd2a_: