Lineage for d2pd2a_ (2pd2 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921138Fold c.114: DsrEFH-like [75168] (1 superfamily)
    3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 43215
  4. 2921139Superfamily c.114.1: DsrEFH-like [75169] (3 families) (S)
  5. 2921200Family c.114.1.0: automated matches [191517] (1 protein)
    not a true family
  6. 2921201Protein automated matches [190869] (1 species)
    not a true protein
  7. 2921202Species Sulfolobus tokodaii [TaxId:273063] [188218] (1 PDB entry)
  8. 2921203Domain d2pd2a_: 2pd2 A: [167135]
    automated match to d1l1sa_

Details for d2pd2a_

PDB Entry: 2pd2 (more details), 2.06 Å

PDB Description: Crystal structure of (ST0148) conserved hypothetical from Sulfolobus Tokodaii Strain7
PDB Compounds: (A:) Hypothetical protein ST0148

SCOPe Domain Sequences for d2pd2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pd2a_ c.114.1.0 (A:) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
mkvvvqikdfdkvpqalrsvinlyndikdaeievvlhqsaikallkdsdtrsiiedlikk
nilivgcensirsqnlshdqlipgikivtsgvgeivrkqsegwiylal

SCOPe Domain Coordinates for d2pd2a_:

Click to download the PDB-style file with coordinates for d2pd2a_.
(The format of our PDB-style files is described here.)

Timeline for d2pd2a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2pd2b_