PDB entry 2pd2

View 2pd2 on RCSB PDB site
Description: Crystal structure of (ST0148) conserved hypothetical from Sulfolobus Tokodaii Strain7
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2007-03-31, released 2007-10-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: 0.186
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein ST0148
    Species: Sulfolobus tokodaii [TaxId:273063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2pd2a_
  • Chain 'B':
    Compound: Hypothetical protein ST0148
    Species: Sulfolobus tokodaii [TaxId:273063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2pd2b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pd2A (A:)
    mkvvvqikdfdkvpqalrsvinlyndikdaeievvlhqsaikallkdsdtrsiiedlikk
    nilivgcensirsqnlshdqlipgikivtsgvgeivrkqsegwiylal
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pd2B (B:)
    mkvvvqikdfdkvpqalrsvinlyndikdaeievvlhqsaikallkdsdtrsiiedlikk
    nilivgcensirsqnlshdqlipgikivtsgvgeivrkqsegwiylal