SCOPe 2.07: Domain d2pd2b_: 2pd2 B:

Lineage for d2pd2b_ (2pd2 B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.114: DsrEFH-like [75168] (1 superfamily)
   3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 43215

4. Superfamily c.114.1: DsrEFH-like [75169] (3 families)

5. Family c.114.1.0: automated matches [191517] (1 protein)
   not a true family

6. Protein automated matches [190869] (1 species)
   not a true protein

7. Species Sulfolobus tokodaii [TaxId:273063] [188218] (1 PDB entry)

8. Domain d2pd2b_: 2pd2 B: [167136]
   automated match to d1l1sa_

Details for d2pd2b_

PDB Entry: 2pd2, 2.06 Å

PDB Description: Crystal structure of (ST0148) conserved hypothetical from Sulfolobus Tokodaii Strain7

PDB Compounds: (B:) Hypothetical protein ST0148

SCOPe Domain Sequences for d2pd2b_:

Sequence; same for both SEQRES and ATOM records:

>d2pd2b_ c.114.1.0 (B:) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
mkvvvqikdfdkvpqalrsvinlyndikdaeievvlhqsaikallkdsdtrsiiedlikk
nilivgcensirsqnlshdqlipgikivtsgvgeivrkqsegwiylal

Timeline for d2pd2b_:

• d2pd2b_ first appeared in SCOPe 2.01
  
• d2pd2b_ appears in SCOPe 2.06
  
• d2pd2b_ appears in the current release, SCOPe 2.08