Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
Superfamily c.72.1: Ribokinase-like [53613] (6 families) has extra strand located between strands 2 and 3 |
Family c.72.1.0: automated matches [191321] (1 protein) not a true family |
Protein automated matches [190117] (18 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [187913] (1 PDB entry) |
Domain d2jg5b_: 2jg5 B: [166172] automated match to d2abqa1 |
PDB Entry: 2jg5 (more details), 2.3 Å
SCOPe Domain Sequences for d2jg5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jg5b_ c.72.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]} miytvtfnpsidyviftndfkidglnratatykfaggkginvsrvlktldvestalgfag gfpgkfiidtlnnsaiqsnfievdedtrinvklktgqeteinapgphitstqfeqllqqi knttsedivivagsvpssipsdayaqiaqitaqtgaklvvdaekelaesvlpyhplfikp nkdelevmfnttvnsdadvikygrllvdkgaqsvivslggdgaiyidkeisikavnpqgk vvntvgsgdstvagmvagiasglsiekafqqavacgtatafdedlatrdaiekiksqvti svldge
Timeline for d2jg5b_: