Lineage for d2abqa1 (2abq A:1-306)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1181243Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 1181244Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 1181245Family c.72.1.1: Ribokinase-like [53614] (10 proteins)
  6. 1181293Protein Fructose 1-phosphate kinase FruB [142712] (1 species)
  7. 1181294Species Bacillus halodurans [TaxId:86665] [142713] (1 PDB entry)
    Uniprot Q9KEM5 1-306
  8. 1181295Domain d2abqa1: 2abq A:1-306 [126528]
    Other proteins in same PDB: d2abqb_
    complexed with po4

Details for d2abqa1

PDB Entry: 2abq (more details), 2.1 Å

PDB Description: crystal structure of fructose-1-phosphate kinase from bacillus halodurans
PDB Compounds: (A:) fructose 1-phosphate kinase

SCOPe Domain Sequences for d2abqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2abqa1 c.72.1.1 (A:1-306) Fructose 1-phosphate kinase FruB {Bacillus halodurans [TaxId: 86665]}
miytvtlnpsidyivqvenfqqgvvnrserdrkqpggkginvsrvlkrlghetkalgflg
gftgayvrnalekeeiglsfievegdtrinvkikgkqetelngtaplikkehvqalleql
telekgdvlvlagsvpqampqtiyrsmtqiakergafvavdtsgealhevlaakpsfikp
nhhelselvskpiasiedaiphvqrligegiesilvsfagdgalfasaegmfhvnvpsge
vrnsvgagdsvvagflaalqegksledavpfavaagsatafsdgfctreeverlqqqlqr
tikkeg

SCOPe Domain Coordinates for d2abqa1:

Click to download the PDB-style file with coordinates for d2abqa1.
(The format of our PDB-style files is described here.)

Timeline for d2abqa1: