![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
![]() | Superfamily c.72.1: Ribokinase-like [53613] (6 families) ![]() has extra strand located between strands 2 and 3 |
![]() | Family c.72.1.1: Ribokinase-like [53614] (10 proteins) automatically mapped to Pfam PF00294 |
![]() | Protein Fructose 1-phosphate kinase FruB [142712] (1 species) |
![]() | Species Bacillus halodurans [TaxId:86665] [142713] (1 PDB entry) Uniprot Q9KEM5 1-306 |
![]() | Domain d2abqa1: 2abq A:1-306 [126528] Other proteins in same PDB: d2abqb_ complexed with po4 |
PDB Entry: 2abq (more details), 2.1 Å
SCOPe Domain Sequences for d2abqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2abqa1 c.72.1.1 (A:1-306) Fructose 1-phosphate kinase FruB {Bacillus halodurans [TaxId: 86665]} miytvtlnpsidyivqvenfqqgvvnrserdrkqpggkginvsrvlkrlghetkalgflg gftgayvrnalekeeiglsfievegdtrinvkikgkqetelngtaplikkehvqalleql telekgdvlvlagsvpqampqtiyrsmtqiakergafvavdtsgealhevlaakpsfikp nhhelselvskpiasiedaiphvqrligegiesilvsfagdgalfasaegmfhvnvpsge vrnsvgagdsvvagflaalqegksledavpfavaagsatafsdgfctreeverlqqqlqr tikkeg
Timeline for d2abqa1: