SCOPe 2.03: Domain d2jg5b_: 2jg5 B:

Lineage for d2jg5b_ (2jg5 B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.1: Ribokinase-like [53613] (6 families)
   has extra strand located between strands 2 and 3

5. Family c.72.1.0: automated matches [191321] (1 protein)
   not a true family

6. Protein automated matches [190117] (34 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [187913] (3 PDB entries)

8. Domain d2jg5b_: 2jg5 B: [166172]
   automated match to d2abqa1

Details for d2jg5b_

PDB Entry: 2jg5, 2.3 Å

PDB Description: crystal structure of a putative phosphofructokinase from staphylococcus aureus

PDB Compounds: (B:) fructose 1-phosphate kinase

SCOPe Domain Sequences for d2jg5b_:

Sequence; same for both SEQRES and ATOM records:

>d2jg5b_ c.72.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
miytvtfnpsidyviftndfkidglnratatykfaggkginvsrvlktldvestalgfag
gfpgkfiidtlnnsaiqsnfievdedtrinvklktgqeteinapgphitstqfeqllqqi
knttsedivivagsvpssipsdayaqiaqitaqtgaklvvdaekelaesvlpyhplfikp
nkdelevmfnttvnsdadvikygrllvdkgaqsvivslggdgaiyidkeisikavnpqgk
vvntvgsgdstvagmvagiasglsiekafqqavacgtatafdedlatrdaiekiksqvti
svldge

Timeline for d2jg5b_:

• d2jg5b_ first appeared in SCOPe 2.01
  
• d2jg5b_ appears in SCOPe 2.02
  
• d2jg5b_ appears in SCOPe 2.04
  
• d2jg5b_ appears in the current release, SCOPe 2.08