Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) |
Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
Protein automated matches [190202] (2 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [187800] (5 PDB entries) |
Domain d2hdva1: 2hdv A:519-627 [165054] Other proteins in same PDB: d2hdva2 automated match to d1rpyb_ |
PDB Entry: 2hdv (more details), 2 Å
SCOPe Domain Sequences for d2hdva1:
Sequence, based on SEQRES records: (download)
>d2hdva1 d.93.1.1 (A:519-627) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dqplsgypwfhgmlsrlkaaqlvleggtgshgvflvrqsetrrgecvltfnfqgkakhlr lslnaagqcrvqhlhfqsifdmlehfrvhpiplesggssdvvlvsyvps
>d2hdva1 d.93.1.1 (A:519-627) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dqplsgypwfhgmlsrlkaaqlvleggtgshgvflvrqsetrrgecvltfnfqgkakhlr lslnaagqcrvqhlhfqsifdmlehfrvhpipdvvlvsyvps
Timeline for d2hdva1: