PDB entry 2hdv

View 2hdv on RCSB PDB site
Description: Crystal structure of the Src Homology-2 domain of the adapter protein SH2-B
Class: signaling protein
Keywords: SH2, adapter protein, SIGNALING PROTEIN
Deposited on 2006-06-20, released 2006-08-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-02-14, with a file datestamp of 2018-02-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SH2-B PH domain containing signaling mediator 1 gamma isoform
    Species: Mus musculus [TaxId:10090]
    Gene: Sh2bpsm1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WVM5 (2-110)
      • cloning artifact (1)
      • engineered (66-67)
      • engineered (76)
    Domains in SCOPe 2.08: d2hdva1, d2hdva2
  • Chain 'B':
    Compound: SH2-B PH domain containing signaling mediator 1 gamma isoform
    Species: Mus musculus [TaxId:10090]
    Gene: Sh2bpsm1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WVM5 (Start-110)
      • engineered (66-67)
      • engineered (76)
    Domains in SCOPe 2.08: d2hdvb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hdvA (A:)
    gsdqplsgypwfhgmlsrlkaaqlvleggtgshgvflvrqsetrrgecvltfnfqgkakh
    lrlslnaagqcrvqhlhfqsifdmlehfrvhpiplesggssdvvlvsyvps
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hdvA (A:)
    sdqplsgypwfhgmlsrlkaaqlvleggtgshgvflvrqsetrrgecvltfnfqgkakhl
    rlslnaagqcrvqhlhfqsifdmlehfrvhpipdvvlvsyvps
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hdvB (B:)
    gsdqplsgypwfhgmlsrlkaaqlvleggtgshgvflvrqsetrrgecvltfnfqgkakh
    lrlslnaagqcrvqhlhfqsifdmlehfrvhpiplesggssdvvlvsyvps
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hdvB (B:)
    qplsgypwfhgmlsrlkaaqlvleggtgshgvflvrqsetrrgecvltfnfqgkakhlrl
    slnaagqcrvqhlhfqsifdmlehfrvhpipledvvlvsyvps