Lineage for d2hdva1 (2hdv A:519-627)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2571840Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2571841Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2571842Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2572281Protein automated matches [190202] (2 species)
    not a true protein
  7. 2572305Species Mouse (Mus musculus) [TaxId:10090] [187800] (5 PDB entries)
  8. 2572307Domain d2hdva1: 2hdv A:519-627 [165054]
    Other proteins in same PDB: d2hdva2
    automated match to d1rpyb_

Details for d2hdva1

PDB Entry: 2hdv (more details), 2 Å

PDB Description: crystal structure of the src homology-2 domain of the adapter protein sh2-b
PDB Compounds: (A:) SH2-B PH domain containing signaling mediator 1 gamma isoform

SCOPe Domain Sequences for d2hdva1:

Sequence, based on SEQRES records: (download)

>d2hdva1 d.93.1.1 (A:519-627) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dqplsgypwfhgmlsrlkaaqlvleggtgshgvflvrqsetrrgecvltfnfqgkakhlr
lslnaagqcrvqhlhfqsifdmlehfrvhpiplesggssdvvlvsyvps

Sequence, based on observed residues (ATOM records): (download)

>d2hdva1 d.93.1.1 (A:519-627) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dqplsgypwfhgmlsrlkaaqlvleggtgshgvflvrqsetrrgecvltfnfqgkakhlr
lslnaagqcrvqhlhfqsifdmlehfrvhpipdvvlvsyvps

SCOPe Domain Coordinates for d2hdva1:

Click to download the PDB-style file with coordinates for d2hdva1.
(The format of our PDB-style files is described here.)

Timeline for d2hdva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hdva2
View in 3D
Domains from other chains:
(mouse over for more information)
d2hdvb_