Lineage for d2gwhb_ (2gwh B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 987542Family c.37.1.5: PAPS sulfotransferase [52575] (15 proteins)
    Pfam PF00685
    similar to the nucleotide/nucleoside kinases but transfer sulphate group
  6. 987619Protein automated matches [190189] (4 species)
    not a true protein
  7. 987627Species Human (Homo sapiens) [TaxId:9606] [186928] (7 PDB entries)
  8. 987629Domain d2gwhb_: 2gwh B: [164868]
    automated match to d3bfxa1
    complexed with a3p, pci, unx

Details for d2gwhb_

PDB Entry: 2gwh (more details), 1.8 Å

PDB Description: human sulfotranferase sult1c2 in complex with pap and pentachlorophenol
PDB Compounds: (B:) Sulfotransferase 1C2

SCOPe Domain Sequences for d2gwhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gwhb_ c.37.1.5 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krlsvnyvkgilqptdtcdiwdkiwnfqakpddllistypkagttwtqeiveliqnegdv
ekskrapthqrfpflemkipslgsgleqahampsprilkthlpfhllppslleknckiiy
varnpkdnmvsyyhfqrmnkalpapgtweeyfetflagkvcwgswhehvkgwweakdkhr
ilylfyedmkknpkheiqklaefigkklddkvldkivhytsfdvmkqnpmanyssipaei
mdhsispfmrkgavgdwkkhftvaqnerfdedykkkmtdtrltfhfqf

SCOPe Domain Coordinates for d2gwhb_:

Click to download the PDB-style file with coordinates for d2gwhb_.
(The format of our PDB-style files is described here.)

Timeline for d2gwhb_: