SCOPe 2.08: Domain d2gwhb_: 2gwh B:

Lineage for d2gwhb_ (2gwh B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.5: PAPS sulfotransferase [52575] (15 proteins)
   Pfam PF00685
   similar to the nucleotide/nucleoside kinases but transfer sulphate group

6. Protein automated matches [190189] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186928] (11 PDB entries)

8. Domain d2gwhb_: 2gwh B: [164868]
   automated match to d3bfxa1
   complexed with a3p, pci, unx

Details for d2gwhb_

PDB Entry: 2gwh, 1.8 Å

PDB Description: human sulfotranferase sult1c2 in complex with pap and pentachlorophenol

PDB Compounds: (B:) Sulfotransferase 1C2

SCOPe Domain Sequences for d2gwhb_:

Sequence; same for both SEQRES and ATOM records:

>d2gwhb_ c.37.1.5 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krlsvnyvkgilqptdtcdiwdkiwnfqakpddllistypkagttwtqeiveliqnegdv
ekskrapthqrfpflemkipslgsgleqahampsprilkthlpfhllppslleknckiiy
varnpkdnmvsyyhfqrmnkalpapgtweeyfetflagkvcwgswhehvkgwweakdkhr
ilylfyedmkknpkheiqklaefigkklddkvldkivhytsfdvmkqnpmanyssipaei
mdhsispfmrkgavgdwkkhftvaqnerfdedykkkmtdtrltfhfqf

Timeline for d2gwhb_:

• d2gwhb_ first appeared in SCOPe 2.01
  
• d2gwhb_ appears in SCOPe 2.07