![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.5: PAPS sulfotransferase [52575] (15 proteins) Pfam PF00685 similar to the nucleotide/nucleoside kinases but transfer sulphate group |
![]() | Protein automated matches [190189] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186928] (7 PDB entries) |
![]() | Domain d2gwha_: 2gwh A: [164867] automated match to d3bfxa1 complexed with a3p, pci, unx |
PDB Entry: 2gwh (more details), 1.8 Å
SCOPe Domain Sequences for d2gwha_:
Sequence, based on SEQRES records: (download)
>d2gwha_ c.37.1.5 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} rlsvnyvkgilqptdtcdiwdkiwnfqakpddllistypkagttwtqeiveliqnegdve kskrapthqrfpflemkipslgsgleqahampsprilkthlpfhllppslleknckiiyv arnpkdnmvsyyhfqrmnkalpapgtweeyfetflagkvcwgswhehvkgwweakdkhri lylfyedmkknpkheiqklaefigkklddkvldkivhytsfdvmkqnpmanyssipaeim dhsispfmrkgavgdwkkhftvaqnerfdedykkkmtdtrltfhfqf
>d2gwha_ c.37.1.5 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} rlsvnyvkgilqptdtcdiwdkiwnfqakpddllistypkagttwtqeiveliqnegdve kskrapthqrfpflemkipslgsgleqahampsprilkthlpfhllppslleknckiiyv arnpkdnmvsyyhfqrmnkalpapgtweeyfetflagkvcwgswhehvkgwweakdkhri lylfyedmkknpkheiqklaefigkklddkvldkivhytsfdvmkqnpmanyssipaeim dhsispfmrkgavgdwkkhftvaqnerfdedykkkmtrltfhfqf
Timeline for d2gwha_: