Lineage for d2grzb_ (2grz B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1715807Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1715983Protein Hemoglobin I [46464] (2 species)
  7. 1715984Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [46465] (36 PDB entries)
  8. 1716000Domain d2grzb_: 2grz B: [164826]
    automated match to d1nxfa_
    complexed with cmo, hem; mutant

Details for d2grzb_

PDB Entry: 2grz (more details), 1.6 Å

PDB Description: 5ns photoproduct of the m37v mutant of scapharca hbi
PDB Compounds: (B:) Globin-1

SCOPe Domain Sequences for d2grzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2grzb_ a.1.1.2 (B:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
svydaaaqltadvkkdlrdswkvigsdkkgngvalvttlfadnqetigyfkrlgdvsqgm
andklrghsitlmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikkv
lasknfgdkyanawaklvavvqaal

SCOPe Domain Coordinates for d2grzb_:

Click to download the PDB-style file with coordinates for d2grzb_.
(The format of our PDB-style files is described here.)

Timeline for d2grzb_: