SCOPe 2.04: Domain d2grzb_: 2grz B:

Lineage for d2grzb_ (2grz B:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin I [46464] (2 species)

7. Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [46465] (36 PDB entries)

8. Domain d2grzb_: 2grz B: [164826]
   automated match to d1nxfa_
   complexed with cmo, hem; mutant

Details for d2grzb_

PDB Entry: 2grz, 1.6 Å

PDB Description: 5ns photoproduct of the m37v mutant of scapharca hbi

PDB Compounds: (B:) Globin-1

SCOPe Domain Sequences for d2grzb_:

Sequence; same for both SEQRES and ATOM records:

>d2grzb_ a.1.1.2 (B:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
svydaaaqltadvkkdlrdswkvigsdkkgngvalvttlfadnqetigyfkrlgdvsqgm
andklrghsitlmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikkv
lasknfgdkyanawaklvavvqaal

Timeline for d2grzb_:

• d2grzb_ first appeared in SCOPe 2.01
  
• d2grzb_ appears in SCOPe 2.03
  
• d2grzb_ appears in SCOPe 2.05
  
• d2grzb_ appears in the current release, SCOPe 2.08