![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein Hemoglobin I [46464] (2 species) |
![]() | Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [46465] (38 PDB entries) |
![]() | Domain d2grzb_: 2grz B: [164826] automated match to d1nxfa_ complexed with cmo, hem; mutant |
PDB Entry: 2grz (more details), 1.6 Å
SCOPe Domain Sequences for d2grzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2grzb_ a.1.1.2 (B:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]} svydaaaqltadvkkdlrdswkvigsdkkgngvalvttlfadnqetigyfkrlgdvsqgm andklrghsitlmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikkv lasknfgdkyanawaklvavvqaal
Timeline for d2grzb_: