SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2hiod_ (2hio D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1986516Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1986517Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1986518Family a.22.1.1: Nucleosome core histones [47114] (6 protein domains)
    form octamers composed of two copies of each of the four histones
  6. 1986832Protein Histone H4 [47125] (7 species)
  7. 1986913Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47126] (6 PDB entries)
    Uniprot P62801
  8. 1986922Domain d2hiod_: 2hio D: [16468]
    Other proteins in same PDB: d2hioa_, d2hiob_, d2hioc_

Details for d2hiod_

PDB Entry: 2hio (more details), 3.1 Å

PDB Description: histone octamer (chicken), chromosomal protein
PDB Compounds: (D:) protein (histone h4)

SCOPe Domain Sequences for d2hiod_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hiod_ a.22.1.1 (D:) Histone H4 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]}
niqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvtam
dvvyalkrqertlygfgg

SCOPe Domain Coordinates for d2hiod_:

Click to download the PDB-style file with coordinates for d2hiod_.
(The format of our PDB-style files is described here.)

Timeline for d2hiod_: