Lineage for d2hioa_ (2hio A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698057Protein Histone H2A [47115] (7 species)
  7. 2698141Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47116] (6 PDB entries)
    Uniprot P02263
  8. 2698150Domain d2hioa_: 2hio A: [16438]
    Other proteins in same PDB: d2hiob_, d2hioc_, d2hiod_

Details for d2hioa_

PDB Entry: 2hio (more details), 3.1 Å

PDB Description: histone octamer (chicken), chromosomal protein
PDB Compounds: (A:) protein (histone h2a)

SCOPe Domain Sequences for d2hioa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hioa_ a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]}
ksrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardnk
ktriiprhlqlairndeelnkllgkvtiaqggvlpniqavl

SCOPe Domain Coordinates for d2hioa_:

Click to download the PDB-style file with coordinates for d2hioa_.
(The format of our PDB-style files is described here.)

Timeline for d2hioa_: