SCOP 1.63: Domain d1hioa_: 1hio A:

Lineage for d1hioa_ (1hio A:)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (3 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H2A [47115] (4 species)

7. Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47116] (4 PDB entries)

8. Domain d1hioa_: 1hio A: [16439]
   Other proteins in same PDB: d1hiob_, d1hioc_, d1hiod_

Details for d1hioa_

PDB Entry: 1hio, 3.1 Å

PDB Description: histone octamer (chicken), chromosomal protein, alpha carbons only

SCOP Domain Sequences for d1hioa_:

Sequence; same for both SEQRES and ATOM records:

>d1hioa_ a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus), erythrocytes}
ksrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardnk
ktriiprhlqlairndeelnkllgkvtiaqggvlp

Timeline for d1hioa_:

• d1hioa_ first appeared (with stable ids) in SCOP 1.55
  
• d1hioa_ appears in SCOP 1.61
  
• d1hioa_ appears in SCOP 1.65
  
• d1hioa_ appears in the current release, SCOPe 2.08