Lineage for d1hiod_ (1hio D:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 211635Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 211636Superfamily a.22.1: Histone-fold [47113] (3 families) (S)
  5. 211637Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
    form octamers composed of two copies of each of the four histones
  6. 211723Protein Histone H4 [47125] (4 species)
  7. 211742Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47126] (4 PDB entries)
  8. 211748Domain d1hiod_: 1hio D: [16469]
    Other proteins in same PDB: d1hioa_, d1hiob_, d1hioc_

Details for d1hiod_

PDB Entry: 1hio (more details), 3.1 Å

PDB Description: histone octamer (chicken), chromosomal protein, alpha carbons only

SCOP Domain Sequences for d1hiod_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hiod_ a.22.1.1 (D:) Histone H4 {Chicken (Gallus gallus), erythrocytes}
qgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvtamdv
vyalkrqgrtlygfgg

SCOP Domain Coordinates for d1hiod_:

Click to download the PDB-style file with coordinates for d1hiod_.
(The format of our PDB-style files is described here.)

Timeline for d1hiod_: